Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKT LLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLH ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISA DAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGM EGRKKKFES
    • Molecular weight
      24 kDa
    • Amino acids
      2 to 210

Specifications

Our Abpromise guarantee covers the use of ab207624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    >= 95 % Ion Exchange Chromatography.
    ab207624 was purified by ion-exchange chromatography in conjunction with calcium dependent affinity chromatography on troponin-I agarose.
  • Form
    Liquid
  • Additional notes

    Identity confirmed using anti-Human cardiac Troponin-I monoclonal antibody.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.61% Tris, 36% Urea

General Info

  • Alternative names
    • cardiac muscle
    • Cardiac troponin I
    • cardiomyopathy, dilated 2A (autosomal recessive)
    • Cardiomyopathy, familial hypertrophic, 7, included
    • CMD1FF
    • CMD2A
    • CMH7
    • cTnI
    • Familial hypertrophic cardiomyopathy 7
    • MGC116817
    • RCM1
    • Tn1
    • Tni
    • TNN I3
    • TNNC 1
    • TNNC1
    • TNNI3
    • TNNI3_HUMAN
    • Troponin I
    • Troponin I cardiac
    • Troponin I cardiac muscle
    • Troponin I cardiac muscle isoform
    • Troponin I type 3 cardiac
    • troponin I, cardiac 3
    • TroponinI
    • Ttroponin I type 3 (cardiac)
    see all
  • Function
    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Involvement in disease
    Defects in TNNI3 are the cause of cardiomyopathy familial hypertrophic type 7 (CMH7) [MIM:613690]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TNNI3 are the cause of cardiomyopathy familial restrictive type 1 (RCM1) [MIM:115210]. RCM1 is an heart muscle disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 2A (CMD2A) [MIM:611880]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 1FF (CMD1FF) [MIM:613286]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities
    Belongs to the troponin I family.
  • Information by UniProt

References

This product has been referenced in:
  • Khodayari Bavil A & Kim J A capillary flow-driven microfluidic system for microparticle-labeled immunoassays. Analyst N/A:N/A (2018). Read more (PubMed: 29878004) »
  • Hong L  et al. High performance immunochromatographic assay for simultaneous quantitative detection of multiplex cardiac markers based on magnetic nanobeads. Theranostics 8:6121-6131 (2018). Read more (PubMed: 30613287) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up