Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFATMYPYDVPDYASSEP PPPPQPPTHQASVGLLDTPRSRERSPSPLRGNVVPSPLPTRRTRTFSATV RASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGD EVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVISS
    • Molecular weight
      44 kDa including tags
    • Amino acids
      2 to 147

Specifications

Our Abpromise guarantee covers the use of ab116535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Mass spectrometry
    MALDI-TOF-TOF
  • Form
    Liquid
  • Additional notes
    ab116535 was alkylated, digested with trypsin and the mass of the resultant peptides determined by MADLI-TOF/TOF. The peptides obtained gave 43 % sequence coverage of CRHSP24. Theoretical pI: 6.08
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.02% Brij, 0.012% Benzamidine, 0.003% EGTA, 0.003% PMSF, 0.1% Beta mercaptoethanol, 0.79% Tris HCl, 9.24% Sucrose, 0.88% Sodium chloride

General Info

  • Alternative names
    • Calcium regulated heat stable protein (24kD)
    • Calcium regulated heat stable protein 1
    • Calcium regulated heat stable protein 1 (24kD)
    • Calcium-regulated heat stable protein 1
    • Calcium-regulated heat-stable protein of 24 kDa
    • Carhsp1
    • CHSP1_HUMAN
    • CRHSP-24
    • CRHSP24
    • CSDC1
    see all
  • Function
    Binds mRNA and regulates the stability of target mRNA. Binds single-stranded DNA (in vitro).
  • Sequence similarities
    Contains 1 CSD (cold-shock) domain.
  • Post-translational
    modifications
    Dephosphorylated by calcineurin in a Ca(2+) dependent manner.
  • Cellular localization
    Cytoplasm. Cytoplasm > P-body. Cytoplasmic granule. Detected at cytoplasmic stress granules and P-bodies. Detected at exosome granules where mRNA is degraded.
  • Information by UniProt

Images

  • 12 % SDS-PAGE gel showing ab116535.

References

ab116535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Ratings

Application
Western blot

Review text: We used this HA-tagged CARHSP1 protein only as a control to quantify our own HA-tagged proteins on a Western blot. For this it worked well, although there are weak degradation products as well as the main 44 kDa band for CARHSP1.
Sample: Human Recombinant protein
Loading amount: 0.3 µg
Treatment: diluted in 0.8M Tris, 0.2M sorbitol, 1% betamercaptoethanol, with bromophenol blue. Added 1% SDS then boiled for 5 min.
Gel Running Conditions: Reduced Denaturing (15% acrylamide gel)
Blocking step: Milk as blocking agent for 18 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 10°C

Other product details
Dilution: 1/100
Incubation time: 1 hour(s) and 0 minute(s) · Temperature: 20°C · Diluent: TBS + 0.1% tween

Primary antibody (in addition to 'CARHSP1 protein')
Name: Non-Abcam antibody was used: anti-HA
Host species: Rabbit
Dilution: 1/2000

Secondary antibody
Name: Non-Abcam antibody was used: anti-rabbit ECL
Clonality: Polyclonal
Dilution: 1/5000

Detection
Detection method: ECL
Exposure: 4 second(s)
Bands: Specific: 44 kDa Non-specific: 30, 35 kDa

Additional data
Additional Notes: Non-specific bands (30, 35kDa) may be due to degradation.

Abcam user community

Verified customer

Submitted Sep 24 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up