Description

  • Product name

    Recombinant Human Carma 1/CARD11 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPS SCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV
    • Amino acids

      481 to 580
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CARD11.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 0610008L17Rik
    • 2410011D02Rik
    • Bcl10 interacting maguk protein 3
    • BIMP 3
    • BIMP3
    • CAR11_HUMAN
    • CARD 11
    • CARD containing MAGUK protein 3
    • Card maguk protein 1
    • CARD-containing MAGUK protein 1
    • CARD11
    • CARD11 protein
    • Carma 1
    • CARMA1
    • Caspase recruitment domain containing protein 11
    • Caspase recruitment domain family member 11
    • Caspase recruitment domain-containing protein 11
    • MGC133069
    see all
  • Function

    Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Activates NF-kappa-B via BCL10 and IKK. Stimulates the phosphorylation of BCL10.
  • Tissue specificity

    Detected in adult peripheral blood leukocytes, thymus, spleen and liver. Also found in promyelocytic leukemia HL-60 cells, chronic myelogenous leukemia K562 cells, Burkitt's lymphoma Raji cells and colorectal adenocarcinoma SW480 cells. Not detected in HeLa S3, Molt-4, A549 and G431 cells.
  • Sequence similarities

    Contains 1 CARD domain.
    Contains 1 guanylate kinase-like domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications

    Phosphorylation at Ser-559, Ser-644 and Ser-652 by PRKCBB leads to a shift from an inactive to an active form that activates the NF-kappa-B signaling.
  • Cellular localization

    Cytoplasm. Membrane raft. Colocalized with DPP4 in membrane rafts.
  • Information by UniProt

Images

  • ab164588 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up