Recombinant Human Carma 3 protein (ab153305)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQD KGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAA
    • Amino acids
      566 to 655
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153305 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as CARD10.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bcl10 binding protein and activator of NFKB
    • BIMP1
    • CAR10_HUMAN
    • CARD 10
    • CARD containing MAGUK 3 protein
    • CARD-containing MAGUK 3
    • CARD-containing MAGUK protein 3
    • CARD10
    • Carma 3
    • CARMA3
    • Caspase Recruitment Domain family member 10
    • Caspase recruitment domain-containing protein 10
    see all
  • Function
    Activates NF-kappa-B via BCL10 and IKK.
  • Tissue specificity
    Detected in adult heart, kidney and liver; lower levels in intestine, placenta, muscle and lung. Also found in fetal lung, liver and kidney.
  • Sequence similarities
    Contains 1 CARD domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153305 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153305 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153305.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up