Overview

  • Product name

    Recombinant Human CARS protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKV TWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITDIDD KIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQ MLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDS TLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVN FVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEG EGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSA MAGTLLGASMDIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHL TIAGCKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTME SALQYEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTA IHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPNQALLENIALY LTHMLKIFGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRK IAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPTVVKLVDRNTLLKE REEKRRVEEEKRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSK FDENGLPTHDMEGKELSKGQAKKLKKLFEAQEKLYKEYLQMAQNGSFQ
    • Molecular weight

      85 kDa
    • Amino acids

      1 to 748
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Functional Studies

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 20% Glycerol, 1.17% Sodium chloride, 78% PBS

General Info

  • Alternative names

    • Cysteine tRNA ligase
    • Cars
    • CysRS
    • Cysteine--tRNA ligase
    • Cysteinyl tRNA synthetase, cytoplasmic
    • Cysteinyl-tRNA synthetase
    • cytoplasmic
    • MGC:11246
    • SYCC_HUMAN
    see all
  • Involvement in disease

    Note=A chromosomal aberration involving CARS is associated with inflammatory myofibroblastic tumors (IMTs). Translocation t(2;11)(p23;p15) with ALK.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab185581 (3.5μg)

References

ab185581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up