Overview

  • Product name
    Recombinant Human CASC5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVSSEANEENDNIERPVRRRHSSILKPPRSPLQDHRGGNERVQESNALRN KKNSRRVSFADTIKVFQTESHMKIVRKSEMEGCSAMVPSQLQLLPP
    • Amino acids
      3 to 98
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein D40/AF15q14
    • AF15Q14
    • ALL1 fused gene from chromosome 15q14
    • Blinkin bub linking kinetochore protein
    • Cancer susceptibility candidate 5
    • Cancer susceptibility candidate gene 5 protein
    • Cancer/testis antigen 29
    • CT29
    • D40
    • hKNL 1
    • hSpc105
    • KIAA1570
    • Kinetochore null 1 homolog
    • Kinetochore null protein 1
    • Kinetochore scaffold 1
    • KNL1
    see all
  • Relevance
    Part of the MIS12 complex, which may be fundamental for kinetochore formation and proper chromosome segregation during mitosis. Four known isoforms exist.
  • Cellular localization
    Acrosome. Nucleus.

Images

  • ab163471 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up