Recombinant Human Casein protein (ab158215)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMN RQRNILREKQTDEIKDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKCA EQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLNQLAAYPYAVW YYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW
    • Amino acids
      1 to 185
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha casein
    • alpha-S1-casein
    • CASA
    • CASA1_HUMAN
    • Casein alpha s1
    • casein, alpha
    • casein, alpha-S1, included
    • Casoxin-D
    • CSN1
    • CSN1S1
    • Csna
    • MGC149368
    see all
  • Function
    Important role in the capacity of milk to transport calcium phosphate.
    Casoxin D acts as opioid antagonist and has vasorelaxing activity mediated by bradykinin B1 receptors.
  • Tissue specificity
    Mammary gland specific. Secreted in milk.
  • Sequence similarities
    Belongs to the alpha-casein family.
  • Post-translational
    modifications
    Not glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158215 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up