Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPPGSHMGSEFMSLQRLLQHSSNGNLADFCAGPAYS SYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQR KLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGL QAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETLNGTMILKRTELE AKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFG PLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFS RQTSTDDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNLSSMF GTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF
    • Molecular weight

      43 kDa including tags
    • Amino acids

      1 to 359
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004279

Specifications

Our Abpromise guarantee covers the use of ab202201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as PSCDBP.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • B3-1
    • B31
    • CASP
    • Cbp HE
    • CYBR
    • CYTHIP
    • Cytip
    • CYTIP_HUMAN
    • Cytohesin 1 interacting protein
    • Cytohesin binder and regulator
    • Cytohesin-associated scaffolding protein
    • Cytohesin-binding protein HE
    • Cytohesin-interacting protein
    • HE
    • Pleckstrin Homology Sec7 and Coiled-Coil Domains Binding Protein
    • Pleckstrin homology Sec7 and coiled-coil domains-binding protein
    • Pleckstrin homology, Sec7 and coiled/coil domains, binding protein
    see all
  • Function

    By its binding to cytohesin-1 (CYTH1), it modifies activation of ARFs by CYTH1 and its precise function may be to sequester CYTH1 in the cytoplasm.
  • Tissue specificity

    Expressed in lymph nodes, thymus, spleen, lung, peripheral blood leukocytes and bone marrow.
  • Sequence similarities

    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Cytoplasm. Early endosome. Recruited from the cytosol to endosomes by SNX27.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202201 (3 µg).

References

ab202201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up