Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIIC NEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFA HRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN CPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIK KAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEI FRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab39901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Activity : >5000 units/mg
  • Applications

    Functional Studies

  • Form
    Lyophilised
  • Additional notes

    Active caspase-1 is useful in studying enzyme regulation, determining target substrates, screening caspase inhibitors, or as a positive control in caspase activity assays. The active caspase 1 preferentially cleaves caspase-1 substrates (e.g., YVAD-AFC or YVAD-pNA)

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute to 1 unit per µl in PBS containing 15% glycerol

General Info

  • Alternative names
    • CASP1
    • CASP1 nirs variant 1
    • Caspase 1 apoptosis related cysteine peptidase
    • caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
    • ICE
    • ICE-like protease
    • IL1 B convertase
    • IL1 beta converting enzyme
    • IL1BC
    • IL1BCE
    • Interleukin 1 B converting enzyme
    • Interleukin 1 beta convertase
    • P45
    see all
  • Relevance
    Caspases are a family of cysteine proteases that are key mediators of programmed cell death or apoptosis. The precursor form of all caspases is composed of a prodomain, and large and small catalytic subunits. The active forms of caspases are generated by several stimuli including ligand-receptor interactions, growth factor deprivation and inhibitors of cellular functions. All known caspases require cleavage adjacent to aspartates to liberate one large and one small subunit, which associate into a2b2 tetramer to form the active enzyme. Caspase 1 is similar to the cell death gene CED3 of C. elegans and regulates multiple proinflammatory cytokines, including Interleukin 1b and interferon-gamma-inducing factor. Caspase 1 plays a role in down stream of Caspase 8 which is involved in Fas-mediated apoptosis.
  • Cellular localization
    Cytoplasmic

References

This product has been referenced in:
  • Du M  et al. Transgenic Mice Overexpressing Serum Retinol-Binding Protein Develop Progressive Retinal Degeneration through a Retinoid-Independent Mechanism. Mol Cell Biol 35:2771-89 (2015). Functional Studies . Read more (PubMed: 26055327) »
See 1 Publication for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Answer

Thank you for your reply.

I certainly understand that the mass concentration would be imperative when using in Western blot. Unfortunately this is considered proprietary information and I cannot provide it.
I've looked through our catalog and we do not have any other human caspase 1 proteins. Iapologize for this inconvenience and that I do not have a better answer to provide.

Please let me know if you have any further questions or if there is anything else that we can do for you, and I'll be happy to help.

Read More

Answer

Thank you for your call earlier this week and for your patience while I have been in touch with the producing lab about ab39901.

This protein is provided as the heterotetramer of the small (10 kDa) and large (20 kDa) subunits of caspase 1. It is not the immature protein. It is packaged as 25 units per vial, so there isn't a specific mass per vial, but it should be a few micrograms based on the activity of >5000 units/mg.

I hope this information will be useful, but please let me know if you have any further questions and I'll be happy to help.

Read More

Answer

Thank you for contacting Abcam.

For ab39901, Caspase 1, we recommend using 1 unit/assay for analyzing caspase activity and this protein has a biological activity : >5000 units/mg and it is supplied lyophilized and it should be reconstituted to 1 unit per µl in PBS containing 15% glycerol (and as it supplied as 25 units you would end up with 25ul of solution).

For ab52101, Caspase 3, one unit of the recombinant caspase-3 is the enzyme activity that cleaves 1 nmol of the caspase substrate DEVD-pNA (pNA: pnitroanaline) per hour at 37oC in a reaction solution containing 50 mM Hepes, pH 7.2, 50 mM NaCl, 0.1% Chaps, 10 mM EDTA, 5% Glycerol, and 10 mM DTT. You are supplied with 100 units and again it is lyophilized on arrival an you should reconstitute to 1 unit per µl in PBS containing 15% glycerol (therefore you would have 100ul of solution).

The above are recommended starting dilutions, however the optimal dilutions/concentrations should be determined by the end user.

Please let me know if there is anything else I can help you with.

Read More

Answer

Thank you for your inquiry. Please see below for the unit definition for ab39901 (Caspase 1 protein (Active)): One unit of the recombinant Caspase-1 is the enzyme activity that cleaves 1 nmol of the caspase substrate YVAD-pNA (pNA: pnitroanaline) per hour at 37C in a reaction solution containing 50 mM Hepes, pH 7.2, 50 mM NaCl, 0.1% Chaps, 10 mM EDTA, 5% Glycerol, and 10 mM DTT. Please note the different substrate to Caspase 3. I hope this information is helpful. Please do not hesitate to contact me again with any further questions.

Read More

Question
Answer

Thank you for contacting us. I have heard back from the lab with the following information: The dilution buffer can be used to dilute the caspase 1 protein (ab39901) when being used as a positive control. Thus, the protocol is correct as it is. Could you please describe the problem you encountered as well as the type of samples you have been using? Were there any deviations from the protocol that you might have implemented? What is the order or PO number used to purchase the kit? Please let me know this information so that I can help you further with resolvng the issues with this product. I look forward to hear back from you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up