Recombinant Human Caspase-10 / CASP-10 protein (ab172829)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSET STKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLG FTVHIHNNVTKVEMEMVLQKQKCNPAHADG DCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFI QACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVS FRHVEEGSWYIQSLCNHLKKLVPRHEDILSILEHHHHHH
    • Molecular weight
      30 kDa including tags
    • Amino acids
      220 to 479
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab172829 is more than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.2% DTT, 0.6% HEPES

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • ALPS2
    • Apoptotic protease Mch-4
    • CASP 10
    • CASP-10
    • CASP10
    • CASPA_HUMAN
    • Caspase 10 apoptosis related cysteine peptidase
    • Caspase-10
    • Caspase-10 subunit p12
    • FADD like ICE2
    • Fas associated death domain protein
    • FAS-associated death domain protein interleukin-1B-converting enzyme 2
    • FLICE 2
    • FLICE2
    • ICE like apoptotic protease 4
    • ICE-like apoptotic protease 4
    • Interleukin 1B converting enzyme 2
    • MCH 4
    see all
  • Function
    Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-
    -AMC and Asp-Glu-Val-Asp-
    -AMC.
    Isoform C is proteolytically inactive.
  • Tissue specificity
    Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon.
  • Involvement in disease
    Defects in CASP10 are the cause of autoimmune lymphoproliferative syndrome type 2A (ALPS2A) [MIM:603909]. ALPS2 is characterized by abnormal lymphocyte and dendritic cell homeostasis and immune regulatory defects.
    Defects in CASP10 are a cause of familial non-Hodgkin lymphoma (NHL) [MIM:605027]. NHL is a cancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss.
    Defects in CASP10 are a cause of gastric cancer (GASC) [MIM:613659]. A malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
  • Sequence similarities
    Belongs to the peptidase C14A family.
    Contains 2 DED (death effector) domains.
  • Post-translational
    modifications
    Cleavage by granzyme B and autocatalytic activity generate the two active subunits.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

References

ab172829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up