Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFES TMKRDPTAEQFQEELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDG EMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPGETVGGDEIVM VIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKG HILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLYLQLEHHHHHH
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 242
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

General Info

  • Alternative names
    • Apoptosis related cysteine protease
    • CASP 14
    • CASP-14
    • CASP14
    • Caspase 14 apoptosis related cysteine protease
    • Caspase 14 precursor
    • Caspase-14 subunit p10
    • Caspase14
    • CASPE_HUMAN
    • MGC119078
    • MGC119079
    • MICE
    • Mini ICE
    see all
  • Function
    Believed to be a non-apoptotic caspase which is involved in epidermal differentiation. Seems to play a role in keratinocyte differentiation and cornification. Probably regulates maturation of the epidermis by proteolytically processing filaggrin.
  • Tissue specificity
    Expressed in keratinocytes of adult skin suprabasal layers (from spinous layers to the stratum granulosum and stratum corneum) (at protein level). Expressed in keratinocytes of hair shaft and sebaceous glands (at protein level). In psoriatic skin only expressed at very low levels.
  • Sequence similarities
    Belongs to the peptidase C14A family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab173054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up