Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQ LLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFD AFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPL YKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRG LALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQE MQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACD MHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHP PT
    • Amino acids
      1 to 452
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CASP 2
    • CASP-2
    • Casp2
    • CASP2_HUMAN
    • Caspase 2
    • Caspase 2 apoptosis related cysteine peptidase
    • Caspase-2 subunit p12
    • Caspase2
    • ICH 1
    • ICH 1 protease
    • ICH 1L
    • ICH1
    • ICH1 protease
    • ICH1L
    • NEDD-2
    • NEDD2
    • Neural precursor cell expressed developmentally down-regulated protein 2
    • PPP1R57
    • Protease ICH-1
    • Protein phosphatase 1 regulatory subunit 57
    see all
  • Function
    Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.
  • Tissue specificity
    Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.
  • Sequence similarities
    Belongs to the peptidase C14A family.
    Contains 1 CARD domain.
  • Post-translational
    modifications
    The mature protease can process its own propeptide, but not that of other caspases.
  • Information by UniProt

Images

  • ab158031 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up