Recombinant human Caspase-6/CASP-6 protein (ab52157)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Caspase-6/CASP-6 protein
See all Caspase-6/CASP-6 proteins and peptides -
Biological activity
SPECIFIC ACTIVITY: 13,000 units/mg
-
Purity
> 95 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIF NHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKI HEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHS LVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTL PAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLT LVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab52157 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is manufactured by BioVision, an Abcam company and was previously called 1086 Caspase-6, human recombinant. 1086-100 is the same size as the 100 unit size of ab52157.
UNIT DEFINITION: One unit of the recombinant Caspase-6 / CASP-6 is the enzyme activity that cleaves 1 nmol of the caspase substrate VEID-pNA (pNA: pnitroanaline) per hour at 37°C in a reaction solution containing 50 mM Hepes, pH 7.2, 50 mM NaCl, 0.1% Chaps, 10 mM EDTA, 5% Glycerol, and 10 mM DTT.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
Constituents: PBS, 15% Glycerol (glycerin, glycerine)
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute to 1 unit per µl in PBS containing 15% glycerol. Following reconstitution in PBS, the enzyme should be aliquoted and immediately stored at –80°C.
General Info
-
Alternative names
- Apoptotic protease Mch-2
- Apoptotic protease MCH2
- CASP-6
see all -
Function
Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death. -
Sequence similarities
Belongs to the peptidase C14A family. -
Post-translational
modificationsCleavages by caspase-3, caspase-8 or -10 generate the two active subunits. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab52157 has been referenced in 3 publications.
- Hung MC et al. AKT phosphorylation as a predictive biomarker for PI3K/mTOR dual inhibition-induced proteolytic cleavage of mTOR companion proteins in small cell lung cancer. Cell Biosci 12:122 (2022). PubMed: 35918763
- Zandy AJ et al. Role of the executioner caspases during lens development. J Biol Chem 280:30263-72 (2005). PubMed: 15994297
- Basu A et al. Proteolytic activation of protein kinase C-epsilon by caspase-mediated processing and transduction of antiapoptotic signals. J Biol Chem 277:41850-6 (2002). PubMed: 12198125