Description

  • Product name

    Recombinant human Caspase-7 protein
    See all Caspase-7 proteins and peptides
  • Biological activity

    Specific Activity: ≥ 5337 pmol/min/µg

     

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKT TRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC FRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVI YGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSG PINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILE EHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY FSQHHHHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      1 to 303
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Active Caspase-7 is a heterotetramer consisting of two copies each of ~20 kDa and ~11 kDa subunits.

Specifications

Our Abpromise guarantee covers the use of ab198478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.05% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Apoptotic protease Mch-3
    • Apoptotic protease MCH3
    • CASP-7
    • CASP7
    • CASP7_HUMAN
    • Caspase 7
    • Caspase 7 apoptosis related cysteine peptidase
    • Caspase-7 subunit p11
    • Caspase7
    • CMH 1
    • CMH-1
    • CMH1
    • ICE LAP3
    • ICE-LAP3
    • ICE-like apoptotic protease 3
    • LICE2
    • MCH3
    see all
  • Function

    Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-
    -Gly-217' bond. Overexpression promotes programmed cell death.
  • Tissue specificity

    Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.
  • Sequence similarities

    Belongs to the peptidase C14A family.
  • Post-translational
    modifications

    Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198478 with Coomassie staining.

    Lane 1: 4.56 μg ab198478 (subunits 1 + 2)
    Lane 2: Protein marker

  • Example of specific activity of ab198478

References

ab198478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up