Description

  • Product name

    Recombinant human Caspase-8 protein
    See all Caspase-8 proteins and peptides
  • Biological activity

    Specific Activity: ≥ 1145 pmol/min/µg

  • Purity

    >= 99 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSK PRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEI KPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEA PIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYL EMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRE RCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSDHH HHHH
    • Predicted molecular weight

      35 kDa including tags
    • Amino acids

      200 to 496
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NM_001228.

Specifications

Our Abpromise guarantee covers the use of ab198070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Peptide notes:  Autocleaved between the prodomain and large protease subunit (p18). The cleavage product, p30, contains both the large (p18) and small (p10 [His-tag]) protease subunits. p30 is further processed to the p18 and p10 subunits, which dimerize to form active enzyme.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ALPS2B
    • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein
    • Apoptosis related cysteine peptidase
    • Apoptotic cysteine protease
    • Apoptotic protease Mch-5
    • Apoptotic protease Mch5
    • CAP 4
    • CAP4
    • CASP-8
    • CASP8
    • CASP8_HUMAN
    • Caspase 8
    • Caspase 8 apoptosis related cysteine peptidase
    • Caspase IIX
    • Caspase-8 subunit p10
    • caspase8
    • CED 3
    • FADD Homologous ICE/CED3 Like Protease
    • FADD Like ICE
    • FADD-homologous ICE/CED-3-like protease
    • FADD-like ICE
    • FLICE
    • FLJ17672
    • ICE-like apoptotic protease 5
    • MACH
    • MACH alpha 1/2/3 protein
    • MACH beta 1/2/3/4 protein
    • MACH5
    • MCH 5
    • MCH5
    • MGC78473
    • MORT1 associated ced 3 homolog
    • MORT1 associated CED3 homolog
    • MORT1-associated CED-3 homolog
    • OTTHUMP00000163717
    • OTTHUMP00000163720
    • OTTHUMP00000163724
    • OTTHUMP00000163725
    • OTTHUMP00000165062
    • OTTHUMP00000165063
    • OTTHUMP00000165064
    • OTTHUMP00000206552
    • OTTHUMP00000206582
    see all
  • Function

    Most upstream protease of the activation cascade of caspases responsible for the TNFRSF6/FAS mediated and TNFRSF1A induced cell death. Binding to the adapter molecule FADD recruits it to either receptor. The resulting aggregate called death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases. Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC. Cleaves and activates CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10. May participate in the GZMB apoptotic pathways. Cleaves ADPRT. Hydrolyzes the small-molecule substrate, Ac-Asp-Glu-Val-Asp-
    -AMC. Likely target for the cowpox virus CRMA death inhibitory protein. Isoform 5, isoform 6, isoform 7 and isoform 8 lack the catalytic site and may interfere with the pro-apoptotic activity of the complex.
  • Tissue specificity

    Isoform 1, isoform 5 and isoform 7 are expressed in a wide variety of tissues. Highest expression in peripheral blood leukocytes, spleen, thymus and liver. Barely detectable in brain, testis and skeletal muscle.
  • Involvement in disease

    Defects in CASP8 are the cause of caspase-8 deficiency (CASP8D) [MIM:607271]. CASP8D is a disorder resembling autoimmune lymphoproliferative syndrome (ALPS). It is characterized by lymphadenopathy, splenomegaly, and defective CD95-induced apoptosis of peripheral blood lymphocytes (PBLs). It leads to defects in activation of T-lymphocytes, B-lymphocytes, and natural killer cells leading to immunodeficiency characterized by recurrent sinopulmonary and herpes simplex virus infections and poor responses to immunization.
  • Sequence similarities

    Belongs to the peptidase C14A family.
    Contains 2 DED (death effector) domains.
  • Domain

    Isoform 9 contains a N-terminal extension that is required for interaction with the BCAP31 complex.
  • Post-translational
    modifications

    Generation of the subunits requires association with the death-inducing signaling complex (DISC), whereas additional processing is likely due to the autocatalytic activity of the activated protease. GZMB and CASP10 can be involved in these processing events.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198070 (7 μg) with Coomassie staining.

  • Example of specific activity of ab198070.

References

ab198070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up