Overview

  • Product name
    Recombinant Human CAST protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADF APECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEA GGGLTCASA
    • Amino acids
      2 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PAF49.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A34.5
    • Anti sense to ERCC 1 protein
    • Antisense to ERCC-1 protein
    • ASE 1
    • ASE-1
    • ASE1
    • CAST
    • CD3 epsilon associated protein
    • CD3-epsilon-associated protein
    • CD3E antigen, epsilon polypeptide associated protein
    • CD3E associated protein
    • CD3e molecule, epsilon associated protein
    • CD3E-associated protein
    • CD3EAP
    • DNA directed RNA polymerase I subunit RPA34
    • DNA-directed RNA polymerase I subunit RPA34
    • MGC118851
    • PAF 49
    • PAF49
    • RNA polymerase I associated factor PAF49
    • RNA polymerase I-associated factor PAF49
    • RPA34_HUMAN
    see all
  • Function
    DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Isoform 1 is involved in UBTF-activated transcription, presumably at a step following PIC formation.
    Isoform 2 has been described as a component of preformed T-cell receptor (TCR) complex.
  • Sequence similarities
    Belongs to the eukaryotic RPA34 RNA polymerase subunit family.
  • Post-translational
    modifications
    Isoform 2 undergoes tyrosine phosphorylation upon T-cell receptor (TCR) stimulation. This phosphorylation has not been confirmed by other group.
    Isoform 1 is phosphorylated on tyrosine residues in initiation-competent Pol I-beta complexes but not in Pol I-alpha complexes.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus > nucleolus. Chromosome. Found at the fibrillar centers of the nucleolus in interphase and during cell division it is localized to the nucleolus organizer regions of the chromosomes.
  • Information by UniProt

Images

  • ab161174 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up