Description

  • Product name

    Recombinant human Cathepsin B protein
    See all Cathepsin B proteins and peptides
  • Biological activity

    Specific Activity: ≥ 4048 pmol/min/µg

    Assay condition: 25 mM MES, pH 5.0, 10 μM substrate (Z-Leu-Arg-AMC), 10 min, room temperature. Prior to assay enzyme was activated with preincubation at 10 μg/ml in 25 mM MES, pH 5.0, 5 mM DTT for 15 min at RT.

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLLLLLPLLWAGALARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVD MSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRD QGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCN GGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGE GDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEG AFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWN TDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      18 to 339
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 18 to 339. The signal peptide is not included, but it contains CD33 signal peptide (a.a. 1-16) instead.

Specifications

Our Abpromise guarantee covers the use of ab198475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Amyloid precursor protein secretase
    • APP secretase
    • APPS
    • CATB_HUMAN
    • Cathepsin B heavy chain
    • Cathepsin B1
    • CathepsinB
    • CPSB
    • CTSB
    • cysteine protease
    • OTTHUMP00000116009
    • OTTHUMP00000229510
    • OTTHUMP00000229511
    • OTTHUMP00000229512
    • OTTHUMP00000229514
    • OTTHUMP00000229515
    • OTTHUMP00000229516
    • Preprocathepsin B
    see all
  • Function

    Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 10% SDS Page analysis of ab198475 with Coomassie staining.

    Lane 1: 7 μg ab198475
    Lane 2: Protein marker

  • Example of specific activity of ab198475.

References

ab198475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up