Description

  • Product name

    Recombinant Human Cathepsin E protein (His tag)
    See all Cathepsin E proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEP LINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSR FQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESV TEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYM SSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTV MFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNV MPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWI LGDVFIRQFYSVFDRGNNRVGLAPAVP
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      20 to 396
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the full length protein. The signal peptide is not included. Predicted N-terminus: Ser 20 (propeptide and mature chain) or Ile 54 (mature chain).

Specifications

Our Abpromise guarantee covers the use of ab219688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CATE
    • CATE_HUMAN
    • Cathepsin E
    • Cathepsin E form II
    • CTSE
    • Erythrocyte membrane aspartic proteinase
    • Slow moving proteinase
    see all
  • Function

    May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
  • Tissue specificity

    Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.
  • Sequence similarities

    Belongs to the peptidase A1 family.
  • Post-translational
    modifications

    Glycosylated. The nature of the carbohydrate chain varies between cell types. In fibroblasts, the proenzyme contains a high mannose-type oligosaccharide, while the mature enzyme contains a complex-type oligosaccharide. In erythrocyte membranes, both the proenzyme and mature enzyme contain a complex-type oligosaccharide.
    Two forms are produced by autocatalytic cleavage, form I begins at Ile-54, form II begins at Thr-57.
  • Cellular localization

    Endosome. The proenzyme is localized to the endoplasmic reticulum and Golgi apparatus, while the mature enzyme is localized to the endosome.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219688 stained overnight with Coomassie Blue.

    The protein migrates as 40-46 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.

References

ab219688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up