Bioactive grade

Recombinant human Cathepsin S protein (ab191650)

Description

  • Product name

    Recombinant human Cathepsin S protein
    See all Cathepsin S proteins and peptides
  • Biological activity

    Measured by its ability to cleave the fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2.

    The specific activity is >300 pmol/min/µg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH SMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILP DSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQN LVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYD SKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGV YYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNK GNHCGIASFPSYPEI
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      17 to 331
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_004070.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      SNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGK LVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKA MDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPS FFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEG YIRMARNKGNHCGIASFPSYPEI
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      109 to 331
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_004070.

Specifications

Our Abpromise guarantee covers the use of ab191650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 6.50
    Constituents: 0.98% MES, 0.58% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Cathepsin S
    • CathepsinS
    • CATS_HUMAN
    • Ctss
  • Function

    Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • Human Cathepsin S (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE analysis of DTT-reduced ab191650 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 37 kDa (pro) and 26 kDa (mature) due to glycosylation.

References

ab191650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up