Overview

  • Product name

    Recombinant human Cathepsin V protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYS QGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKS VDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLV DCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPEN SVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFE PDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAK DKNNHCGIATAASYPNV
    • Molecular weight

      37 kDa including tags
    • Amino acids

      18 to 334
    • Tags

      His tag C-Terminus
    • Additional sequence information

      With CD33 signal peptide (aa 1-16); NM_001333.2.

Specifications

Our Abpromise guarantee covers the use of ab198089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥ 436 pmol/min/µg.

     

    Assay Conditions: 25 mM sodium acetate pH 5.5, 0.1 M NaCl, 5 mM DTT, 25 µM substrate (Z-Leu-Arg-AMC), 5 min, room temperature.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    >= 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    ab198089 is expressed in FreeStyle 293-F cells.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.53% Imidazole
    Constituents: 0.05% DTT, 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CAT L2
    • Cathepsin L2
    • Cathepsin U
    • Cathepsin V
    • CathepsinL2
    • CathepsinU
    • CathepsinV
    • CATL 2
    • CATL2
    • CATL2_HUMAN
    • CTS L2
    • CTS U
    • CTS V
    • CTSL 2
    • CTSL2
    • CTSU
    • CTSV
    • MGC125957
    • PRO305
    • UNQ268
    see all
  • Function

    Cysteine protease. May have an important role in corneal physiology.
  • Tissue specificity

    Predominantly expressed in the thymus and testis. Also expressed in corneal epithelium, and to a lesser extent in conjunctival epithelium and skin.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • Activity assay using ab198089.

  • 10% SDS-PAGE analysis of 3 µg of ab198089 with Coomassie staining.

References

ab198089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up