Description

  • Product name

    Recombinant Human Cathepsin Z protein (denatured)
    See all Cathepsin Z proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLPKSWDWRNVDGVNYASITRNQHIPQY CGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDL SVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLW RVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTY INHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARY NLAIEEHCTFGDPIV
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      62 to 303
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Carboxypeptidase LB
    • Cathepsin B2
    • Cathepsin IV
    • Cathepsin P
    • Cathepsin X
    • Cathepsin X precursor
    • Cathepsin Y
    • Cathepsin Z
    • Cathepsin Z precursor
    • Cathepsin Z1
    • CathepsinP
    • CathepsinX
    • CathepsinZ
    • CATZ_HUMAN
    • CTSX
    • CTSZ
    • Cysteine type carboxypeptidase
    • FLJ17088
    • Lysosomal carboxypeptidase B
    • Preprocathepsin P
    • PreprocathepsinP
    see all
  • Function

    Exhibits carboxy-monopeptidase as well as carboxy-dipeptidase activity.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171674 (3µg).

References

ab171674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up