Recombinant Human Cav2.3 protein (ab158014)

Overview

  • Product name
    Recombinant Human Cav2.3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQDIFQLA CMDPADDGQFQERQSLVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERS
    • Amino acids
      1901 to 1999
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha-1 polypeptide
    • BII
    • Brain calcium channel II
    • CAC 1E
    • CAC1E
    • CAC1E_HUMAN
    • CACH 6
    • CACH6
    • CACNA1E
    • Cacnl1 a6
    • CACNL1A6
    • Calcium channel
    • Calcium channel, L type, alpha 1 polypeptide, isoform 6
    • calcium channel, R type
    • Cav 2.3
    • Cchra 1
    • Cchra1
    • isoform 6
    • L type
    • Voltage dependent R type calcium channel subunit alpha 1E
    • Voltage gated calcium channel subunit alpha Cav2.3
    • Voltage-dependent R-type calcium channel subunit alpha-1E
    • Voltage-gated calcium channel subunit alpha Cav2.3
    see all
  • Function
    Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1E gives rise to R-type calcium currents. R-type calcium channels belong to the 'high-voltage activated' (HVA) group and are blocked by nickel, and partially by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to dihydropyridines (DHP), omega-conotoxin-GVIA (omega-CTx-GVIA), and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing alpha-1E subunit could be involved in the modulation of firing patterns of neurons which is important for information processing.
  • Tissue specificity
    Expressed in neuronal tissues and in kidney.
  • Sequence similarities
    Belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family. CACNA1E subfamily.
    Contains 1 EF-hand domain.
  • Domain
    Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up