For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-caveolin-1-protein-ab114170.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Lipids / Lipoproteins Lipid Metabolism Cholesterol Metabolism
Share by email

Recombinant Human Caveolin-1 protein (ab114170)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Caveolin-1 protein (ab114170)
  • Western blot - Recombinant Human Caveolin-1 protein (ab114170)

Key features and details

  • Expression system: Wheat germ
  • Suitable for: SDS-PAGE, WB, ELISA

Description

  • Product name

    Recombinant Human Caveolin-1 protein
    See all Caveolin-1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

    Q03135
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID LVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFY RLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSI YVHTVCDPLFEAVGKIFSNVRINLQKEI
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      1 to 178
    • Additional sequence information

      There is a GST tag at N-terminal end.

Associated products

  • Related Products

    • Anti-Caveolin-1 antibody - Caveolae Marker (ab18199)
    • Anti-Caveolin-1 antibody - Caveolae Marker (ab2910)
    • Anti-Caveolin-1 antibody (ab36152)
    • Anti-Caveolin-1 (phospho Y14) antibody (ab38468)
    • Anti-Caveolin-1 (phospho Y14) antibody [EPR2288Y] (ab75876)

Specifications

Our Abpromise guarantee covers the use of ab114170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BSCL3
    • CAV
    • CAV1
    • CAV1_HUMAN
    • caveolae protein, 22 kD
    • caveolin 1 alpha isoform
    • caveolin 1 beta isoform
    • Caveolin 1 caveolae protein 22kDa
    • Caveolin-1
    • Caveolin1
    • cell growth-inhibiting protein 32
    • CGL3
    • LCCNS
    • MSTP085
    • OTTHUMP00000025031
    • PPH3
    • VIP 21
    • VIP21
    see all
  • Function

    May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway.
  • Tissue specificity

    Expressed in muscle and lung, less so in liver, brain and kidney.
  • Involvement in disease

    Defects in CAV1 are the cause of congenital generalized lipodystrophy type 3 (CGL3) [MIM:612526]; also called Berardinelli-Seip congenital lipodystrophy type 3 (BSCL3). Congenital generalized lipodystrophies are autosomal recessive disorders characterized by a near absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes.
  • Sequence similarities

    Belongs to the caveolin family.
  • Post-translational
    modifications

    The initiator methionine for isoform Beta is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.
  • Cellular localization

    Golgi apparatus membrane. Cell membrane. Membrane > caveola. Membrane raft. Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.
  • Target information above from: UniProt accession Q03135 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human Caveolin-1 protein (ab114170)
    SDS-PAGE - Recombinant Human Caveolin-1 protein (ab114170)
    ab114170 on a 12.5% SDS-PAGE Stained with Coomassie Blue.
  • Western blot - Recombinant Human Caveolin-1 protein (ab114170)
    Western blot - Recombinant Human Caveolin-1 protein (ab114170)

    ab18199 recognizes the full length tagged recombinant Caveolin 1 protein (ab114170) which has an expected molecular weight of 46 kDa.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab114170? Please let us know so that we can cite the reference in this datasheet.

ab114170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab114170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.