Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEFPRVVPDQRSKFENEEFFRKLSR ECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASW QGEQRQTPSREYVDLEREAGKVYLKAPM ILNGVCVIWKGWIDLQRLDG MGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQL LAVTGKKTTRP
    • Molecular weight

      25 kDa including tags
    • Amino acids

      2 to 182
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Full-length Human CBFb (182 aa, derived from BC018509 ) gene was constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag.

Specifications

Our Abpromise guarantee covers the use of ab203552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab203552 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • CBF b
    • CBF beta
    • CBF-beta
    • CBFB
    • CBFbeta
    • Core binding factor beta subunit
    • core binding factor subunit beta
    • Core-binding factor subunit beta
    • Core-binding factor, beta subunit (CBFB), transcript variant 2
    • PEA 2
    • PEA2
    • PEA2 beta
    • PEA2-beta
    • PEA2beta
    • PEBB_HUMAN
    • PEBP 2B
    • PEBP2 beta
    • PEBP2-beta
    • PEBP2B
    • PEBP2beta
    • Polyomavirus enhancer binding protein 2 beta subunit
    • Polyomavirus enhancer-binding protein 2 beta subunit
    • SL3 3 enhancer factor 1 beta subunit
    • SL3 3 enhancer factor 1 subunit beta
    • SL3-3 enhancer factor 1 subunit beta
    • SL3/AKV core binding factor beta subunit
    • SL3/AKV core-binding factor beta subunit
    see all
  • Function

    CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
  • Involvement in disease

    Note=A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13;q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
  • Sequence similarities

    Belongs to the CBF-beta family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab203552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up