Description

  • Product name

    Recombinant Human CBFb protein
    See all CBFb proteins and peptides
  • Purity

    >= 85 % SDS-PAGE.
    ab98252 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPRVVPDQRSKFENEEFFRKLSRECEIKYT GFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQT PSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEE RAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT RP
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 182
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98252 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 6.00
    Constituents: 0.39% MES, 0.00174% PMSF, 10% Glycerol

General Info

  • Alternative names

    • CBF b
    • CBF beta
    • CBF-beta
    • CBFB
    • CBFbeta
    • Core binding factor beta subunit
    • core binding factor subunit beta
    • Core-binding factor subunit beta
    • Core-binding factor, beta subunit (CBFB), transcript variant 2
    • PEA 2
    • PEA2
    • PEA2 beta
    • PEA2-beta
    • PEA2beta
    • PEBB_HUMAN
    • PEBP 2B
    • PEBP2 beta
    • PEBP2-beta
    • PEBP2B
    • PEBP2beta
    • Polyomavirus enhancer binding protein 2 beta subunit
    • Polyomavirus enhancer-binding protein 2 beta subunit
    • SL3 3 enhancer factor 1 beta subunit
    • SL3 3 enhancer factor 1 subunit beta
    • SL3-3 enhancer factor 1 subunit beta
    • SL3/AKV core binding factor beta subunit
    • SL3/AKV core-binding factor beta subunit
    see all
  • Function

    CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
  • Involvement in disease

    Note=A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13;q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
  • Sequence similarities

    Belongs to the CBF-beta family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab98252

References

This product has been referenced in:

  • Malik N  et al. The transcription factor CBFB suppresses breast cancer through orchestrating translation and transcription. Nat Commun 10:2071 (2019). Read more (PubMed: 31061501) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98252.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up