For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-cbx1-hp1-beta-protein-ab109847.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromatin Binding Proteins Methyl Lysine
Share by email

Recombinant Human CBX1 / HP1 beta protein (ab109847)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human CBX1 / HP1 beta protein (ab109847)
  • Western blot - Recombinant Human CBX1 / HP1 beta protein (ab109847)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 85% SDS-PAGE
  • Tags: His tag N-Terminus
  • Suitable for: SDS-PAGE, WB

Description

  • Product name

    Recombinant Human CBX1 / HP1 beta protein
    See all CBX1 / HP1 beta proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab109847 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

    P83916
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGKKQNKKKVEEVLEEEEEEYVVEKVLDRR VVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS EGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSG ELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDK KDDKN
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      1 to 185
    • Tags

      His tag N-Terminus

Associated products

  • Related Products

    • Anti-CBX1 / HP1 beta antibody (ab10478)
    • Anti-CBX1 / HP1 beta antibody [MAC353] (ab10811)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)

Specifications

Our Abpromise guarantee covers the use of ab109847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.058% Sodium chloride

General Info

  • Alternative names

    • CBX
    • CBX 1
    • Cbx1
    • CBX1_HUMAN
    • Chromobox 1
    • chromobox homolog 1
    • Chromobox homolog 1 (HP1 beta homolog Drosophila )
    • Chromobox protein homolog 1
    • Drosophila HP1 beta
    • Heterochromatin protein 1 beta
    • Heterochromatin protein 1 homolog beta
    • Heterochromatin protein p25
    • heterochromatin protein p25 beta
    • HP1 beta
    • HP1 beta homolog
    • HP1 beta homolog Drosophila
    • HP1, Drosophila. homolog of, beta
    • HP1beta
    • HP1Hs beta
    • HP1Hsbeta
    • Human heterochromatin protein p25 mRNA complete cds
    • M31
    • MOD 1
    • MOD1
    • Modifier 1 protein
    • p25beta
    see all
  • Function

    Component of heterochromatin. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. Interaction with lamin B receptor (LBR) can contribute to the association of the heterochromatin with the inner nuclear membrane.
  • Tissue specificity

    Expressed in all adult and embryonic tissues.
  • Sequence similarities

    Contains 2 chromo domains.
  • Post-translational
    modifications

    Not phosphorylated.
    Ubiquitinated.
  • Cellular localization

    Nucleus. Unassociated with chromosomes during mitosis.
  • Target information above from: UniProt accession P83916 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human CBX1 / HP1 beta protein (ab109847)
    SDS-PAGE - Recombinant Human CBX1 / HP1 beta protein (ab109847)
    15% SDS-PAGE showing ab109847 at approximately 23.6 kDa (3µg).
  • Western blot - Recombinant Human CBX1 / HP1 beta protein (ab109847)
    Western blot - Recombinant Human CBX1 / HP1 beta protein (ab109847)
    Anti-CBX1 / HP1 beta antibody (ab10478) at 1/500 dilution + Recombinant Human CBX1 / HP1 beta protein (ab109847) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 10 seconds

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (0)

Publishing research using ab109847? Please let us know so that we can cite the reference in this datasheet.

ab109847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab109847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.