Description

  • Product name

    Recombinant Human CBX2 protein
    See all CBX2 proteins and peptides
  • Purity

    >= 79 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSEELSSVGEQVFAAECILSK RLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNR KRGKRPRGRPRKLTAMSSCS
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      2 to 90
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab198750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for protein binding assays, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 20% Glycerol

General Info

  • Alternative names

    • Cbx 2
    • CBX2
    • CBX2_HUMAN
    • CDC A6
    • CDCA6
    • Cell division cycle associated 6
    • Cell division cycle associated6
    • Chromobox homolog 2
    • chromobox homolog 2 (Pc class homolog, Drosophila)
    • Chromobox homolog2
    • Chromobox protein homolog 2
    • hromobox homolog 2
    • M33
    • M33 polycomb like
    • MOD 2
    • MOD2
    • Modifier 3
    • Modifier3
    • Pc class homolog
    • Polycomb
    • SRXY5
    see all
  • Function

    Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Involved in sexual development, acting as activator of NR5A1 expression.
  • Involvement in disease

    Defects in CBX2 are the cause of 46,XY sex reversal type 5 (SRXY5) [MIM:613080]. It is a disorder of sex development. Affected individuals have a 46,XY karyotype but present as phenotypically normal females.
  • Sequence similarities

    Contains 1 A.T hook DNA-binding domain.
    Contains 1 chromo domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198750 (2.2 μg) with Coomassie staining.

References

ab198750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up