Description

  • Product name

    Recombinant Human cbx7 protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEP EEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      2 to 90
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_175709

Specifications

Our Abpromise guarantee covers the use of ab198427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.04% Tween

General Info

  • Alternative names

    • Cbx 7
    • CBX7
    • Chromobox homolog 7
    • Chromobox protein homolog 7
  • Relevance

    Control of cell proliferation by Polycomb group proteins (PcG) is an important facet of cellular homeostasis and its disruption can promote tumorigenesis. CBX7 is a novel PcG protein which is found to control the growth of normal cells. CBX7 is a gene that encodes a Polycomb protein, as shown by sequence homology, its interaction with Ring1 and its localization to nuclear Polycomb bodies. CBX7 extends the lifespan of a wide range of normal human cells and immortalizes mouse fibroblasts by downregulating expression of the Ink4a/Arf locus. CBX7 does not inter-function or colocalize with Bmi1, and both can exert their actions independently of each other as shown by reverse genetics. CBX7 was highly expressed in three different prostate cancer cell lines and present at elevated levels in normal prostate. (Gil et al., 2004).
  • Cellular localization

    Nuclear

Images

  • 4-20% SDS-PAGE analysis of ab198427 with Coomassie staining. 

    Lane 1: 2 µg ab198427 
    Lane 2: Protein Marker

References

ab198427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up