Description

  • Product name

    Recombinant Human CCBE1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLAS NTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPS PDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLM LADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPR RTETRDLRAPRDFYP
    • Amino acids

      1 to 215
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCBE 1
    • ccbe1
    • CCBE1_HUMAN
    • Collagen and calcium binding EGF domain containing protein 1
    • Collagen and calcium binding EGF domains 1
    • Collagen and calcium-binding EGF domain-containing protein 1
    • FLJ30681
    • Full of fluid protein homolog
    • MGC50861
    see all
  • Function

    Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis.
  • Tissue specificity

    Not expressed in blood or lymphatic endothelial cells.
  • Involvement in disease

    Defects in CCBE1 are the cause of Hennekam lymphangiectasia-lymphedema syndrome (HLYLMP) [MIM:235510]. HLYLMP is a generalized lymph-vessels dysplasia characterized by intestinal lymphangiectasia with severe lymphedema of the limbs, genitalia and face. In addition, affected individuals have unusual facies and severe mental retardation.
  • Sequence similarities

    Belongs to the CCBE1 family.
    Contains 2 collagen-like domains.
    Contains 1 EGF-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab165553 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up