Description

  • Product name

    Recombinant Human CCBL1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab202192 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAKQLQARRLDGIDYNPWVEFVKLASE HDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILA SFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDC YEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKA LVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHI SIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSV FHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV GLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLV AIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 442
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_004050.

Specifications

Our Abpromise guarantee covers the use of ab202192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Beta lyase
    • Beta lysase, kidney
    • CCBL 1
    • Cysteine conjugate beta lyase
    • Cysteine conjugate beta lyase, cytoplasmic
    • Cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase)
    • Cysteine S conjugate beta lyase
    • Cytoplasmic cysteine conjugate beta lyase
    • FLJ95217
    • Glutamine phenylpyruvate aminotransferase
    • Glutamine transaminase K
    • GTK
    • KAT1
    • KATI
    • Kyneurenine aminotransferase
    • Kynurenine aminotransferase I
    • Kynurenine oxoglutarate transaminase 1
    • MGC29624
    • OTTHUMP00000022311
    • OTTHUMP00000022312
    see all
  • Relevance

    CCBL1 is a cytosolic enzyme which is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism leads to the formation of reactive metabolites which can lead to nephrotoxicity and neurotoxicity. CCBL1 catalyzes the irreversible transamination of the L-tryptophan metabolite L-kinurenine to form kynurenic acid (KA). It catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond. This enzyme has a central role in the bioactivation of nephrotoxic halogenated hydrocarbons - the possibility of human exposure to these chemicals has focused interest on the CCBL1 from human kidney.
  • Cellular localization

    Cytoplasmic

Images

  • 15% SDS-PAGE analysis of ab202192 (3 μg).

References

ab202192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up