Description

  • Product name

    Recombinant Human CCDC134 protein
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab194049 was determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKG LFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRF PRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGIS EKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRI SRSQSELVDHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      23 to 229
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein, aa23-229. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • CC134_HUMAN
    • ccdc134
    • coiled-coil domain containing 134
    • Coiled-coil domain-containing protein 134
    • dJ821D11.3
    • FLJ22349
    • MGC21013
    see all
  • Sequence similarities

    Belongs to the UPF0388 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab194049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up