Overview

  • Product name

    Recombinant Human CCDC76 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAMEE EDARKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRD ETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDHIMSHPALHDA LNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWV DIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKI PVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIK NDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEY FRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEH DDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSP ALQYYTDPLVSLENVLLTALPNHSSSPETTA
    • Amino acids

      1 to 481
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ccdc76
    • Coiled coil domain containing 76
    • Coiled-coil domain-containing protein 76
    • FLJ10287
    • FLJ11219
    • TRM13_HUMAN
    • TRMT13
    • tRNA [Gm4] methyltransferase
    • tRNA guanosine-2'-O-methyltransferase TRM13 homolog
    • tRNA methyltransferase 13 homolog (S. cerevisiae)
    • tRNA:m(4)X modification enzyme TRM13 homolog
    see all
  • Function

    Specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.
  • Sequence similarities

    Belongs to the TRM13 family.
    Contains 1 CHHC-type zinc finger.
  • Information by UniProt

Images

  • ab162754 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up