Overview

  • Product name
    Recombinant Human CCDC90B protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSGYDRRPVDITPLEQRKLTFDTHALVQD LETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHL DAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLD INLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIAS LKTLMESNKLE
    • Molecular weight
      24 kDa including tags
    • Amino acids
      43 to 230
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab1567210 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • CC90B_HUMAN
    • Ccdc90b
    • Coiled coil domain containing 90B
    • Coiled coil domain containing protein 90B mitochondrial
    • Coiled-coil domain-containing protein 90B
    • MDS011
    • MDS025
    • MGC104239
    • mitochondrial
    see all
  • Sequence similarities
    Belongs to the CCDC90 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Mitochondrion. Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156720 (3µg).

References

ab156720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up