Description

  • Product name

    Recombinant Human CCK2-R protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVR NQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGP GSGSRPTQAKLLA
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      215 to 327

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

    Protein previously labeled as CCKBR.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCK B
    • CCK B receptor
    • CCK BR
    • CCK-B receptor
    • CCK-BR
    • CCK2 R
    • CCK2 receptor
    • CCK2-R
    • CCKB
    • CCKB receptor
    • CCKBR
    • CCKR Type B
    • CCKRB
    • Cholecystokinin 2 receptor
    • Cholecystokinin B receptor
    • Cholecystokinin-2 receptor
    • Cholecystokinin2 receptor
    • CholecystokininB receptor
    • GASR
    • GASR_HUMAN
    • Gastrin receptor
    • Gastrin/cholecystokinin type B receptor
    • Gastrin\cholecystokinin brain receptor
    see all
  • Function

    Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
    Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.
  • Tissue specificity

    Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC28 cell lines, not expressed in GLC19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up