Description

  • Product name

    Recombinant Human CCL14 protein
    See all CCL14 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab104678 is purified using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQR IMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      20 to 93
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

General Info

  • Alternative names

    • CC-1
    • CC-3
    • CCL14
    • CCL14_HUMAN
    • chemokine (C-C motif) ligand 14
    • Chemokine CC-1/CC-3
    • chemokine CC1
    • chemokine CC3
    • chemokine HCC1
    • chemokine HCC3
    • CKb1
    • HCC 1
    • HCC 3
    • HCC-1(1-74)
    • HCC-1(9-74)
    • HCC-1/HCC-3
    • HCC-3
    • HCC1
    • HEMOFILTRATE CC CHEMOKINE 1
    • MCIF
    • NCC-2
    • NCC2
    • new CC chemokine 2
    • SCYA14
    • SCYL2
    • small inducible cytokine subfamily A (Cys-Cys), member 14
    • Small-inducible cytokine A14
    • SY14
    see all
  • Function

    Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induced intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and was inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.
  • Tissue specificity

    Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    The N-terminal processed forms HCC-1(3-74), HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood.
    HCC-1(1-74), but not HCC-1(3-74) and HCC-1(4-74), is partially O-glycosylated; the O-linked glycan consists of one Gal-GalNAc disaccharide, further modified by two N-acetylneuraminic acids.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104678.

References

ab104678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up