Description

  • Product name

    Recombinant Human CCL18 protein (BSA and azide free)
    See all CCL18 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAQVGTNKELCCLVYTSWQIPQKFIVDYSE TSPQCPKPGVILLTK RGRQICADPNKKWVQKYISDLKLNA
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      21 to 89
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173065 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • Alternative macrophage activation associated CC chemokine 1
    • Alternative macrophage activation-associated CC chemokine 1
    • AMAC-1
    • AMAC1
    • CC chemokine PARC
    • CCL18
    • CCL18(4-69)
    • CCL18_HUMAN
    • CKb7
    • DC-CK1
    • DCCK1
    • Dendritic cell chemokine 1
    • Macrophage inflammatory protein 4
    • MIP-4
    • MIP4
    • PARC
    • Pulmonary and activation regulated chemokine
    • Pulmonary and activation-regulated chemokine
    • SCYA18
    • Small inducible cytokine A18
    • Small-inducible cytokine A18
    see all
  • Function

    Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
  • Tissue specificity

    Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab173065 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173065.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up