For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-ccl21-protein-ab222174.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Beta Chemokines (CC)
Share by email

Recombinant Human CCL21 protein (ab222174)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human CCL21 protein (ab222174)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: <= 1.000 Eu/µg
    • Suitable for: SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human Exodus 2 ELISA Kit (CCL21) (ab193759)

    View more associated products

    Description

    • Product name

      Recombinant Human CCL21 protein
      See all CCL21 proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      <=1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      O00585
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAE LCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK RTERSQTPKGP
      • Predicted molecular weight

        12 kDa
      • Amino acids

        24 to 134
      • Additional sequence information

        This product is the mature full length protein from aa 24 to 134. The signal peptide is not included.

    Associated products

    • Related Products

      • Anti-CCL21 antibody [EPR6218] (ab129014)

    Specifications

    Our Abpromise guarantee covers the use of ab222174 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

      Constituent: 0.1% Trifluoroacetic acid

      Lyophilized from a sterile 0.2 micron filtered solution.

    • Reconstitution
      Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

    General Info

    • Alternative names

      • 6Ckine
      • Beta chemokine exodus 2
      • Beta-chemokine exodus-2
      • C C motif chemokine ligand 21
      • C-C motif chemokine 21
      • CCL21
      • CCL21_HUMAN
      • Chemokine (C-C motif) ligand 21
      • Chemokine CC motif ligand 21
      • CKb9
      • ECL
      • Efficient Chemoattractant for Lymphocytes
      • SCYA21
      • Secondary lymphoid tissue chemokine
      • Secondary lymphoid-tissue chemokine
      • SLC
      • Small inducible cytokine A21
      • Small inducible cytokine subfamily A (Cys-Cys), member 21
      • Small-inducible cytokine A21
      • TCA4
      • UNQ784/PRO1600
      see all
    • Function

      Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
    • Tissue specificity

      Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in tonsil, fetal heart and fetal spleen.
    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession O00585 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human CCL21 protein (ab222174)
      SDS-PAGE - Recombinant Human CCL21 protein (ab222174)

      1 µg ab222174 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

      Lane 1: Non-reducing conditions.

      Lane 2: Reducing conditions.

      ab222174 is predicted to have a molecuar weight of 12.3 kDa, but runs at about 16 kDa.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab222174? Please let us know so that we can cite the reference in this datasheet.

    ab222174 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab222174.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.