Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESY FETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
    • Molecular weight

      11 kDa
    • Amino acids

      22 to 120
    • Additional sequence information

      This product is for the mature full length protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab202791 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract Human T cell population using a concentration range of 10.0-50.0 ng/mL.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 97 % SDS-PAGE.
    Purity is determined by SDS-PAGE and HPLC analyses.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Macrophage Inflammatory Protein 3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Reconstituted protein should be stored in working aliquots and stored at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • C C motif chemokine ligand 23
    • C-C motif chemokine 23
    • C6 beta chemokine
    • CCL 23
    • CCL23
    • CCL23(30-99)
    • CCL23_HUMAN
    • Chemokine (C C motif) ligand 23
    • Chemokine CC motif ligand 23
    • ck beta 8
    • CK-beta-8
    • CKB 8
    • CKB-8
    • Ckb-8-1
    • CKB8
    • Hmrp-2a
    • Macrophage inflammatory protein 3
    • MIP 3
    • MIP-3
    • MIP3
    • MPIF 1
    • MPIF-1
    • MPIF1
    • Myeloid progenitor inhibitory factor 1
    • OTTHUMP00000163948
    • SCYA 23
    • SCYA23
    • Small inducible cytokine A 23
    • Small inducible cytokine subfamily A (Cys-Cys), member 23
    • Small inducible cytokine subfamily A, member 23
    • Small-inducible cytokine A23
    see all
  • Function

    Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are more potent chemoattractants than the small-inducible cytokine A23.
  • Tissue specificity

    High levels in adult lung, liver, skeletal muscle and pancreas. Moderate levels in fetal liver, adult bone marrow and placenta. The short form is the major species and the longer form was detected only in very low abundance. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are found in high levels in synovial fluids from rheumatoid patients.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202791 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202791.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up