Description

  • Product name

    Recombinant human CCL23 protein (Active)
    See all CCL23 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-50 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    >97% as determined by SDS-PAGE and HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESY FETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
    • Predicted molecular weight

      11 kDa
    • Amino acids

      22 to 120
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C C motif chemokine ligand 23
    • C-C motif chemokine 23
    • C6 beta chemokine
    • CCL 23
    • CCL23
    • CCL23(30-99)
    • CCL23_HUMAN
    • Chemokine (C C motif) ligand 23
    • Chemokine CC motif ligand 23
    • ck beta 8
    • CK-beta-8
    • CKB 8
    • CKB-8
    • Ckb-8-1
    • CKB8
    • Hmrp-2a
    • Macrophage inflammatory protein 3
    • MIP 3
    • MIP-3
    • MIP3
    • MPIF 1
    • MPIF-1
    • MPIF1
    • Myeloid progenitor inhibitory factor 1
    • OTTHUMP00000163948
    • SCYA 23
    • SCYA23
    • Small inducible cytokine A 23
    • Small inducible cytokine subfamily A (Cys-Cys), member 23
    • Small inducible cytokine subfamily A, member 23
    • Small-inducible cytokine A23
    see all
  • Function

    Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are more potent chemoattractants than the small-inducible cytokine A23.
  • Tissue specificity

    High levels in adult lung, liver, skeletal muscle and pancreas. Moderate levels in fetal liver, adult bone marrow and placenta. The short form is the major species and the longer form was detected only in very low abundance. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are found in high levels in synovial fluids from rheumatoid patients.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS Page analysis of ab243242

References

ab243242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up