Description

  • Product name

    Recombinant human CCL28/MEC protein
    See all CCL28/MEC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract human lymphocytes using a concentration range of 1.0-10.0 ng/ml. 

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKR RRICVSPHNHTVKQWMKVQAAKKNGKGNVC HRKKHHGKRNSNRAHQGKHETYGHKTPY
    • Predicted molecular weight

      12 kDa
    • Amino acids

      20 to 127
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab202812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CCL28

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.75% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • C C motif chemokine ligand 28
    • C-C motif chemokine 28
    • CC chemokine CCL28
    • CCK 1
    • CCK1
    • CCK1 protein
    • CCL 28
    • CCL28
    • CCL28_HUMAN
    • Chemokine (C-C motif) ligand 28
    • chemokine (C-C motif) ligand 28 splice variant chi
    • MEC
    • Mucosae associated epithelial chemokine
    • Mucosae-associated epithelial chemokine
    • Protein CCK1
    • SCYA28
    • Small inducible cytokine A28 [Precursor]
    • small inducible cytokine subfamily A (Cys-Cys), member 28
    • Small-inducible cytokine A28
    see all
  • Function

    Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
  • Tissue specificity

    Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up