Recombinant Human CCL4L1 protein (ab107149)

Overview

  • Product name
    Recombinant Human CCL4L1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFV VDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
    • Molecular weight
      11 kDa including tags
    • Amino acids
      24 to 92
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107149 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.50
    Constituents: 0.294% Sodium citrate, 10% Glycerol

General Info

  • Alternative names
    • AT744.2
    • C-C motif chemokine 4-like
    • CC4L_HUMAN
    • CCL4L
    • CCL4L2
    • LAG 1
    • LAG-1
    • LAG1
    • Lymphocyte activation gene 1 protein
    • Macrophage inflammatory protein 1-beta
    • MIP-1-beta
    • Monocyte adherence-induced protein 5-alpha
    • SCYA4L
    • Small-inducible cytokine A4-like
    see all
  • Function
    Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.
  • Tissue specificity
    Detected in B-cells.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107149 (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher than predicted.

References

ab107149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up