Recombinant Human CCL4/MIP-1 beta protein (Fc Chimera) (ab216244)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level: < 0.060 Eu/µg
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human CCL4/MIP-1 beta protein (Fc Chimera)
See all CCL4/MIP-1 beta proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
< 0.060 Eu/µg -
Expression system
CHO cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQV CADPSESWVQEYVYDLELN -
Predicted molecular weight
8 kDa -
Amino acids
24 to 92 -
Additional sequence information
Extracellular domain of Human CCL4 fused to the N-terminus of the Fc region of Human IgG1. This product is for the mature full length protein. The signal peptide is not included (AAI04227.1).
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab216244 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
-
ReconstitutionReconstitute vial in 100µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- MIP 1 beta
- Secreted protein G 26
- ACT 2
see all -
Function
Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsN-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab216244 has not yet been referenced specifically in any publications.