Recombinant Human CCL4/MIP-1 beta protein (Fc Chimera) (ab216244)

Submit a review Submit a question

Key features and details

  • Expression system: CHO cells
  • Purity: >= 98% SDS-PAGE
  • Endotoxin level: < 0.060 Eu/µg
  • Suitable for: SDS-PAGE

Description

  • Product name

    Recombinant Human CCL4/MIP-1 beta protein (Fc Chimera)
    See all CCL4/MIP-1 beta proteins and peptides

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg

  • Expression system

    CHO cells

  • Accession

    P13236

  • Protein length

    Full length protein

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQV CADPSESWVQEYVYDLELN

    • Predicted molecular weight

      8 kDa

    • Amino acids

      24 to 92

    • Additional sequence information

      Extracellular domain of Human CCL4 fused to the N-terminus of the Fc region of Human IgG1. This product is for the mature full length protein. The signal peptide is not included (AAI04227.1).

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab216244 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized

    • Additional notes

       This product was previously labelled as Macrophage Inflammatory Protein 1 beta, MIP1 beta

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.

      Constituent: 100% PBS

    • Reconstitution
      Reconstitute vial in 100µl sterile water. Add 1X PBS to the desired protein concentration.

    General Info

    • Alternative names

      • MIP 1 beta
      • Secreted protein G 26
      • ACT 2
      • ACT-2
      • ACT2
      • AT744.1
      • AT744.2
      • C C motif chemokine 4
      • C C motif chemokine 4 like
      • C C motif chemokine ligand 4 like 1
      • C C motif chemokine ligand 4 like 2
      • CC chemokine ligand 4
      • CC chemokine ligand 4L1
      • CC chemokine ligand 4L1d2
      • CC chemokine ligand 4L2
      • CCL4
      • CCL4_HUMAN
      • CCL4L
      • ccl4l 1
      • CCL4L1
      • Chemokine (C C motif) ligand 4
      • Chemokine (C C motif) ligand 4 like 1
      • Chemokine (C C motif) ligand 4 like 1, telomeric
      • Chemokine (C C motif) ligand 4 like 2
      • Chemokine CC Motif Ligand 4
      • G 26
      • G 26 T lymphocyte secreted protein
      • G-26 T-lymphocyte-secreted protein
      • HC21
      • Immune activation 2
      • LAG 1
      • LAG-1
      • LAG1
      • Lymphocyte activation gene 1
      • Lymphocyte activation gene 1 protein
      • Macrophage inflammatory protein 1 beta
      • Macrophage inflammatory protein 1-beta
      • Macrophage inflammatory protein 1b2
      • MGC104418
      • MGC126025
      • MGC126026
      • MIP-1-beta
      • MIP-1-beta(1-69)
      • MIP-1-beta(3-69)
      • MIP1 beta
      • MIP1B
      • MIP1B1
      • Monocyte adherence induced protein 5 alpha
      • PAT 744
      • Protein H400
      • SCYA2
      • SCYA4
      • SCYA4L
      • SCYA4L1
      • SCYA4L2
      • SCYQ4L2
      • Secreted protein G 26
      • Secreted protein G26
      • SIS gamma
      • SIS-gamma
      • Small inducible cytokine A4
      • Small inducible cytokine A4 (homologous to mouse Mip 1b)
      • small inducible cytokine A4-like
      • Small-inducible cytokine A4
      • T cell activation protein 2
      • T-cell activation protein 2
      see all

    • Function

      Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B.

    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.

    • Post-translational
      modifications

      N-terminal processed form MIP-1-beta(3-69) is produced by proteolytic cleavage after secretion from peripheral blood lymphocytes.

    • Cellular localization

      Secreted.
    • Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab216244? Please let us know so that we can cite the reference in this datasheet.

    ab216244 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab216244.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com