Description

  • Product name

    Recombinant Human CCM2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab174451 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEVKYLGQLTSIPGYLNPSSRTEILHFI DNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIAAV SYVRDDAAHLVVLKTDDSSTKVDIKETYEVEASTFCFPESVDVGGASPHS KTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHE FCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITD SFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDEWDRMISDISSDIE ALGCSMDQDSA
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      66 to 353
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: NP_001161407

Specifications

Our Abpromise guarantee covers the use of ab174451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • C7orf22
    • Ccm2
    • CCM2 gene
    • CCM2_HUMAN
    • Cerebral cavernous malformation 2
    • Cerebral cavernous malformations 2 protein
    • Chromosome 7 open reading frame 22
    • Malcavernin
    • MGC4067
    • MGC4607
    • MGC74868
    • OSM
    • Osmosensing scaffold for MEKK3
    • OTTHUMP00000159554
    • OTTHUMP00000214270
    • OTTHUMP00000214271
    • OTTHUMP00000214273
    • PP10187
    see all
  • Function

    May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock.
  • Involvement in disease

    Defects in CCM2 are the cause of cerebral cavernous malformations type 2 (CCM2) [MIM:603284]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and are usually present clinically during the 3rd to 5th decades of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.
  • Sequence similarities

    Contains 1 PID domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174451 (3 µg)

References

ab174451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up