Description

  • Product name

    Recombinant human CCN3 protein (Active)
    See all CCN3 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1.0 μg/ml, corresponding to a specific activity of >1000 IU/mg.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCS DLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPS CKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPD EEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFST RVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHL QFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVM VIGTCTCHTNCPKNNEAFLQELELKTTRGKM
    • Predicted molecular weight

      36 kDa
    • Amino acids

      28 to 357
    • Additional sequence information

      This product contains the mature full length protein from aa 32 to 357 and 4 aa of the signal peptide (aa 28 to 31).

Specifications

Our Abpromise guarantee covers the use of ab242211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • CCN family member 3
    • CCN3
    • IBP-9
    • IGF-binding protein 9
    • IGFBP-9
    • IGFBP9
    • Insulin-like growth factor-binding protein 9
    • Nephroblastoma overexpressed
    • Nephroblastoma overexpressed gene protein homolog
    • Nephroblastoma-overexpressed gene protein homolog
    • NOV
    • NOV_HUMAN
    • NovH
    • Protein NOV homolog
    see all
  • Function

    Immediate-early protein likely to play a role in cell growth regulation.
  • Tissue specificity

    Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab242211.

References

ab242211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up