Description

  • Product name

    Recombinant Human CCNDBP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNRE MFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFI AVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLI SYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDP YSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRA SKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRI KELTQSELEL
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 360

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AU022347
    • CCDB1_HUMAN
    • CCNDBP 1
    • Ccndbp1
    • Cyclin D type binding protein 1
    • Cyclin-D1-binding protein 1
    • D type cyclin interacting protein 1
    • DIP 1
    • DIP1
    • GCIP
    • Grap 2 and cyclin D interacting protein
    • Grap 2 cyclin D interacting protein GCIP
    • Grap 2 cyclin interacting protein
    • Grap2 and cyclin D interacting protein
    • Grap2 and cyclin-D-interacting protein
    • Grap2 cyclin D interacting protein GCIP
    • Grap2 cyclin interacting protein
    • HHM
    • HHM protein
    • Human homolog of Maid
    • MAID
    • MAID protein
    • Maternal inhibition of differentiation
    • MGC109078
    • OTTMUSP00000017037
    • RP23 263D22.2
    • SECC 8
    • SSEC 8
    • Stage specific embryonic cDNA 8
    see all
  • Function

    May negatively regulate cell cycle progression. May act at least in part via inhibition of the cyclin-D1/CDK4 complex, thereby preventing phosphorylation of RB1 and blocking E2F-dependent transcription.
  • Tissue specificity

    Ubiquitously expressed. Expression is down-regulated in a variety of tumor types including breast, colon, prostate and rectal tumors, and is up-regulated in certain hepatic carcinomas.
  • Sequence similarities

    Belongs to the CCNDBP1 family.
  • Developmental stage

    Expression may increase during differentiation.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132170 stained with Coomassie Blue.

References

ab132170 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up