Description

  • Product name

    Recombinant Human CCNL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEV SLTIDHSLIPEERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLP QVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVI NVFHHLRQLRGKSDQLHLPKPG
    • Amino acids

      1 to 172
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ania 6a
    • CCNL1
    • CCNL1_HUMAN
    • Cyclin L
    • Cyclin L gamma
    • Cyclin L1
    • Cyclin-L
    • Cyclin-L1
    see all
  • Function

    Transcriptional regulator which participates in regulating the pre-mRNA splicing process. Seems to be involved in the regulation of RNA polymerase II (pol II). Functions in association with cyclin-dependent kinases (CDKs) and has a role in the second step of splicing. May be a candidate proto-oncogene in head and neck squamous cell carcinomas (HNSCC). Inhibited by the CDK-specific inhibitor p21.
  • Tissue specificity

    Ubiquitous with higher level in thymus. Overexpression in primary tumors of head and neck squamous cell carcinomas (HNSCC).
  • Sequence similarities

    Belongs to the cyclin family. Cyclin L subfamily.
  • Domain

    Contains a RS region (arginine-serine dipeptide repeat) within the C-terminal domain which is the hallmark of the SR family of splicing factors. This region probably plays a role in protein-protein interactions.
  • Cellular localization

    Nucleus speckle. More specifically found in nuclear intrachromatin granules clusters (IGC), also called nuclear speckles, which are storage compartments for nuclear proteins involved in mRNA processing.
  • Information by UniProt

Images

  • ab163463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up