Description

  • Product name

    Recombinant Human CCNO protein
    See all CCNO proteins and peptides
  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVTPCPTSPSSPAARAGRRDNDQNLRAPVKKSRRPRLRRKQPLHPLNPCP LPGDSGICDLFESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQTFRD YGQSCYAFRKAQESHFHPREALARQPQVTAESRCKLLSWLIPVHRQFGLS FESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQL LALCCGAFSRQQLCNLECIVLHKLHFTLGAPTISFFLEHFTHARVEAGQA EASEALEAQALARGVAELSLADYAFTSYSPSLLAICCLALADRMLRVSRP VDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHMLPVQICEKCSLPPSSK
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      1 to 350
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • CCNO
    • CCNO_HUMAN
    • CCNU
    • Cyclin domain containing
    • Cyclin like uracil DNA glycosylase
    • Cyclin O
    • Cyclin U
    • Cyclin-O
    • DGU
    • EC 3.2.2.
    • UDG2
    • UNG2
    • Uracil DNA glycolylase 2
    • Uracil DNA glycosylase cyclin like
    see all
  • Sequence similarities

    Belongs to the cyclin family.
  • Developmental stage

    Maximum levels during G(1) phase. Levels decrease through S and G(2) phases.
  • Information by UniProt

Images

  • SDS-PAGE showing ab174064

References

ab174064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up