Recombinant Human CCR4 protein (ab253173)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human CCR4 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVF VFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAA DQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRART LTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKV LSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVL FLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQS TMDHDLHDAL -
Predicted molecular weight
41 kDa -
Amino acids
1 to 360 -
Additional sequence information
NP_005499.1
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab253173 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Form
Liquid -
Additional notes
Prepared in an in vitro wheat germ expression system with proprietary liposome technology. By using a mRNA having 5’cap and a poly(A)-tail with this extract in combination with a proprietary liposome, the translation reaction in vitro yields ample quantity of membrane protein which is captured by the liposome leading to correct conformation and folding essential for biological function.
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.4% Tris HCl, 2% Glycerol
General Info
-
Alternative names
- C C chemokine receptor type 4
- C C CKR 4
- C-C chemokine receptor type 4
see all -
Function
High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival. -
Tissue specificity
Predominantly expressed in the thymus, in peripheral blood leukocytes, including T-cells, mostly CD4+ cells, and basophils, and in platelets; at lower levels, in the spleen and in monocytes. Detected also in macrophages, IL-2-activated natural killer cells and skin-homing memory T-cells, mostly the ones expressing the cutaneous lymphocyte antigen (CLA). Expressed in brain microvascular and coronary artery endothelial cells. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Post-translational
modificationsIn natural killer cells, CCL22 binding induces phosphorylation on yet undefined Ser/Thr residues, most probably by beta-adrenergic receptor kinases 1 and 2. -
Cellular localization
Cell membrane. - Information by UniProt
Datasheets and documents
References
ab253173 has not yet been referenced specifically in any publications.