Overview

  • Product name

    Recombinant Human CCR6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      FVIGVLDNLLVVLILVKYKGLKRAENIYLLNLAVSNLCFLLTLPFWAHAG GDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCG IITSVLAWVTAILATLPEYVVYKPQMEDQKYKCAFSRTPFLPADETFWKH FLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFL LMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPL LYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
    • Amino acids

      49 to 344
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CCRL2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C-C chemokine receptor-like 2
    • CCRL2
    • CCRL2_HUMAN
    • Chemokine (C-C motif) receptor like 2
    • Chemokine receptor CCR11
    • Chemokine receptor X
    • CKRX
    • CRAM A
    • CRAM B
    • CRAMA
    • CRAMB
    • FLJ55815
    • HCR
    • MGC116710
    • MGC34104
    • Putative MCP 1 chemokine receptor
    • Putative MCP-1 chemokine receptor
    see all
  • Function

    Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.
  • Tissue specificity

    Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (both CD4+ and CD8+), monocyte-derived iDCs, NK cells, and CD34+ progenitor cells. B cells expressed isoform 1 but not isoform 2. Up-regulated on synovial neutrophils of rheumatoid arthritis patients.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Domain

    Lacks the conserved DRYLAIV motif in the second intracellular loop that is required for signaling of functional chemokine receptors.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab152942 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up