Overview

  • Product name

    Recombinant Human CCT2 protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKI LLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTS VTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSD EVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHI IKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKI FGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPE QLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEE VMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTV KDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIA DNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKR QVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC
    • Molecular weight

      73 kDa including tags
    • Amino acids

      2 to 535
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without initiator methionine. N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TCP1 beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 99D8.1
    • CCT 2
    • CCT beta
    • CCT-beta
    • CCT2
    • CCTB
    • Chaperonin containing t complex polypeptide 1 beta subunit
    • Chaperonin containing t complex polypeptide 1 subunit 2
    • Chaperonin containing TCP1 subunit 2
    • Chaperonin containing TCP1 subunit 2 (beta)
    • CTP:phosphocholine cytidylyltransferase 2
    • Epididymis secretory sperm binding protein Li 100n
    • HEL S 100n
    • MGC142074
    • MGC142076
    • MGC94480
    • PRO1633
    • T complex protein 1 beta subunit
    • T complex protein 1 subunit beta
    • T-complex protein 1 subunit beta
    • TCP 1 beta
    • TCP-1-beta
    • TCPB_HUMAN
    see all
  • Function

    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities

    Belongs to the TCP-1 chaperonin family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab235076 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up